You have no items in your shopping cart.
Cart summary
CXCL1 Protein, Mouse, Recombinant (Active)
Catalog Number: orb2815931
| Catalog Number | orb2815931 |
|---|---|
| Category | Proteins |
| Description | CXCL1 Protein, Mouse, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P12850. |
| Tag | Tag Free |
| Protein Sequence | APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK |
| UniProt ID | P12850 |
| MW | 7.8 kDa (Predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Expression Region | 25-96 aa |
| Storage | -20°C |
| Note | For research use only |
Recombinant Mouse Growth-regulated alpha protein(Cxcl1) (Active) [orb1650703]
5 μg, 100 μg, 1 mg, 20 μg, 250 μg, 500 μg
