CX3CR1 monoclonal antibody (M01), clone 2B11

• Catalog Number: orb2293884
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CX3CR1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CX3CR1 (AAH28078, 1 a.a. ~ 36 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSI
• Tested applications: ELISA, WB
• Clone Number: 2B11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH28078
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CX3CR1 is approximately 10 ng/ml as a capture antibody.

Western Blot detection against Immunogen (29.7 KDa).