CTSZ purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2293893
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CTSZ protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: CTSZ (NP_001327.2, 1 a.a. ~ 303 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
• NCBI: NP_001327.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CTSZ MaxPab polyclonal antibody. Western Blot analysis of CTSZ expression in human liver.

CTSZ MaxPab polyclonal antibody. Western Blot analysis of CTSZ expression in human placenta.

Western Blot analysis of CTSZ expression in transfected 293T cell line by CTSZ MaxPab polyclonal antibody. Lane 1: CTSZ transfected lysate (33.33 KDa). Lane 2: Non-transfected lysate.