You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293915 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human CTSD protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CTSD (AAH16320.1, 1 a.a. ~ 412 a.a) full-length human protein. |
Protein Sequence | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH16320.1 |
CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in mouse brain.
CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in A-431.
CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in human kidney.
CTSD MaxPab rabbit polyclonal antibody. Western Blot analysis of CTSD expression in IMR-32.
Western Blot analysis of CTSD expression in transfected 293T cell line by CTSD MaxPab polyclonal antibody. Lane 1: CTSD transfected lysate (44.60 KDa). Lane 2: Non-transfected lysate.