CTSD monoclonal antibody (M01), clone 3F12-1B9

• Catalog Number: orb2293914
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CTSD.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CTSD (AAH16320, 26 a.a. ~ 412 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: LHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
• Tested applications: ELISA, IHC-P, IP, WB
• Clone Number: 3F12-1B9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH16320

Detection limit for recombinant GST tagged CTSD is approximately 3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CTSD on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]

Immunoprecipitation of CTSD transfected lysate using anti-CTSD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CTSD MaxPab rabbit polyclonal antibody.

Western Blot analysis of CTSD expression in transfected 293T cell line by CTSD monoclonal antibody (M01), clone 3F12-1B9. Lane 1: CTSD transfected lysate (Predicted MW: 44.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (71.06 KDa).