You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293935 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CTNS. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 5G6 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | CTNS (NP_004928, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY |
NCBI | NP_004928 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CTNS monoclonal antibody (M09), clone 5G6. Western Blot analysis of CTNS expression in HepG2.
CTNS monoclonal antibody (M09), clone 5G6. Western Blot analysis of CTNS expression in human liver.
CTNS monoclonal antibody (M09), clone 5G6. Western Blot analysis of CTNS expression in PC-12.
CTNS monoclonal antibody (M09), clone 5G6. Western Blot analysis of CTNS expression in Raw 264.7.
Detection limit for recombinant GST tagged CTNS is approximately 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa).