CTNNA1 monoclonal antibody (M03), clone 4G6

• Catalog Number: orb2293942
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CTNNA1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G6
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CTNNA1 (NP_001894, 152 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQ
• NCBI: NP_001894
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CTNNA1 is approximately 0.3 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between ARRB2 and CTNNA1. HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 and anti-CTNNA1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.63 KDa).