CTHRC1 monoclonal antibody (M05), clone 1G12

• Catalog Number: orb2290688
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CTHRC1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G12
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CTHRC1 (NP_612464, 32 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF
• NCBI: NP_612464
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CTHRC1 is 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CTHRC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

Western Blot analysis of CTHRC1 expression in transfected 293T cell line by CTHRC1 monoclonal antibody (M05), clone 1G12. Lane 1: CTHRC1 transfected lysate(26.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.62 KDa).