CTF1 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2293964
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CTF1 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CTF1 (NP_001321.1, 1 a.a. ~ 201 a.a) full-length human protein.
• Protein Sequence: MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001321.1

CTF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CTF1 expression in Jurkat.

Western Blot analysis of CTF1 expression in transfected 293T cell line by CTF1 MaxPab polyclonal antibody. Lane 1: CTF1 transfected lysate (21.20 KDa). Lane 2: Non-transfected lysate.