You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293964 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human CTF1 protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CTF1 (NP_001321.1, 1 a.a. ~ 201 a.a) full-length human protein. |
Protein Sequence | MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001321.1 |
CTF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CTF1 expression in Jurkat.
Western Blot analysis of CTF1 expression in transfected 293T cell line by CTF1 MaxPab polyclonal antibody. Lane 1: CTF1 transfected lysate (21.20 KDa). Lane 2: Non-transfected lysate.