CTBS purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2293974
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CTBS protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: CTBS (NP_004379.1, 1 a.a. ~ 385 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSRPQLRRWRLVSSPPSGVPGLALLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSISGNLWDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRGIGMWNANCLDYSGDAVAKQQTEEMWEVLKPKLLQR
• NCBI: NP_004379.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CTBS MaxPab rabbit polyclonal antibody. Western Blot analysis of CTBS expression in human liver.

Western Blot analysis of CTBS expression in transfected 293T cell line by CTBS MaxPab polyclonal antibody. Lane 1: CTBS transfected lysate (43.80 KDa). Lane 2: Non-transfected lysate.