CTBS monoclonal antibody (M01), clone 1B5-1B9

• Catalog Number: orb2293973
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CTBS.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B5-1B9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: CTBS (AAH24007.2, 37 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL
• NCBI: AAH24007.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CTBS monoclonal antibody (M01), clone 1B5-1B9 Western Blot analysis of CTBS expression in MCF-7.

Detection limit for recombinant GST tagged CTBS is 0.3 ng/ml as a capture antibody.