CTBS MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2293975
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CTBS protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: CTBS (NP_004379.1, 1 a.a. ~ 385 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSRPQLRRWRLVSSPPSGVPGLALLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSISGNLWDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRGIGMWNANCLDYSGDAVAKQQTEEMWEVLKPKLLQR
• NCBI: NP_004379.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CTBS MaxPab rabbit polyclonal antibody. Western Blot analysis of CTBS expression in human liver.

Immunoprecipitation of CTBS transfected lysate using anti-CTBS MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CTBS MaxPab mouse polyclonal antibody (B01).

Western Blot analysis of CTBS expression in transfected 293T cell line by CTBS MaxPab polyclonal antibody. Lane 1: CTBS transfected lysate (43.8 KDa). Lane 2: Non-transfected lysate.