You have no items in your shopping cart.
Cart summary
CTAG1A Protein, Human, Recombinant (His)
Catalog Number: orb1978881
| Catalog Number | orb1978881 |
|---|---|
| Category | Proteins |
| Description | CTAG1A Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 21.6 kDa and the accession number is P78358. |
| Tag | N-10xHis |
| Purity | 85.00% |
| MW | 21.6 kDa (predicted) |
| UniProt ID | P78358 |
| Protein Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | CTAG1A Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 21.6 kDa and the accession number is P78358. |
| Expression Region | 1-180 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
