You have no items in your shopping cart.
Cart summary
CTAG1A Protein, Human, Recombinant (hFc & Myc)
Catalog Number: orb1978880
| Catalog Number | orb1978880 |
|---|---|
| Category | Proteins |
| Description | CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358. |
| Tag | C-hFc-Myc |
| Purity | 98.00% |
| MW | 48.1 kDa (predicted) |
| UniProt ID | P78358 |
| Protein Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
| Expression System | HEK293 Cells |
| Biological Origin | Human |
| Biological Activity | CTAG1A Protein, Human, Recombinant (hFc & Myc) is expressed in HEK293 mammalian cells with C-hFc-Myc tag. The predicted molecular weight is 48.1 kDa and the accession number is P78358. |
| Expression Region | 1-180 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
