CSTB monoclonal antibody (M02), clone M2-F1

• Catalog Number: orb2293995
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CSTB.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: M2-F1
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: CSTB (AAH03370.1, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
• NCBI: AAH03370.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CSTB monoclonal antibody (M02), clone M2-F1 Western Blot analysis of CSTB expression in A-431.

Immunofluorescence of monoclonal antibody to CSTB on A-431 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to CSTB on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 5 ug/ml]

Western Blot analysis of CSTB expression in transfected 293T cell line by CSTB monoclonal antibody (M02), clone M2-F1. Lane 1: CSTB transfected lysate (11 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.52 KDa).