CSTB monoclonal antibody (M01), clone M1-C1

• Catalog Number: orb2293996
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CSTB.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: M1-C1
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: CSTB (AAH03370.1, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
• NCBI: AAH03370.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CSTB monoclonal antibody (M01), clone M1-C1 Western Blot analysis of CSTB expression in MCF-7.

Detection limit for recombinant GST tagged CSTB is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CSTB on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.52 KDa).