CST3 Antibody - middle region

• Catalog Number: orb2255304
• Category: Antibodies
• Description: CST3 Antibody - middle region
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CST3
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16 kDa
• UniProt ID: P01034
• Protein Sequence: Synthetic peptide located within the following region: PAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRA
• NCBI: NP_000090.1
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ARMD11, HEL-S-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.