CSK monoclonal antibody (M01), clone 3A3

• Catalog Number: orb2294035
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CSK.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CSK (NP_004374, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE
• Tested applications: ELISA, IHC-P, IP, WB
• Clone Number: 3A3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004374

CSK monoclonal antibody (M01), clone 3A3 Western Blot analysis of CSK expression in HL-60.

CSK monoclonal antibody (M01), clone 3A3. Western Blot analysis of CSK expression in Hela S3 NE.

Detection limit for recombinant GST tagged CSK is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CSK on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]

Immunoprecipitation of CSK transfected lysate using anti-CSK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CSK MaxPab rabbit polyclonal antibody.

Western Blot analysis of CSK expression in transfected 293T cell line by CSK monoclonal antibody (M01), clone 3A3. Lane 1: CSK transfected lysate (50.7 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CSK over-expressed 293 cell line, cotransfected with CSK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSK monoclonal antibody (M01) clone 3A3 (Cat # orb2294035). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).