CSH2 purified MaxPab mouse polyclonal antibody (B02P)

• Catalog Number: orb2294037
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CSH2 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Reactivity: Human
• Immunogen: CSH2 (NP_066271.1, 1 a.a. ~ 217 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
• NCBI: NP_066271.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of purified MaxPab antibody to CSH2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western Blot analysis of CSH2 expression in transfected 293T cell line by CSH2 MaxPab polyclonal antibody. Lane 1: CSH2 transfected lysate (23.87 KDa). Lane 2: Non-transfected lysate.