You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294037 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human CSH2 protein. |
Species/Host | Mouse |
Clonality | Polyclonal |
Tested applications | IHC-P, WB |
Reactivity | Human |
Immunogen | CSH2 (NP_066271.1, 1 a.a. ~ 217 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
NCBI | NP_066271.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunoperoxidase of purified MaxPab antibody to CSH2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Western Blot analysis of CSH2 expression in transfected 293T cell line by CSH2 MaxPab polyclonal antibody. Lane 1: CSH2 transfected lysate (23.87 KDa). Lane 2: Non-transfected lysate.