You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294049 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant CSF2RA. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2G5 |
Tested applications | ELISA, PLA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | CSF2RA (AAH02635.1, 1 a.a. ~ 400 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT |
NCBI | AAH02635.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged CSF2RA is 3 ng/ml as a capture antibody.
Proximity Ligation Analysis of protein-protein interactions between KIT and CSF2RA. HeLa cells were stained with anti-KIT rabbit purified polyclonal 1:1200 and anti-CSF2RA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of CSF2RA expression in transfected 293T cell line by CSF2RA monoclonal antibody (M03), clone 2G5. Lane 1: CSF2RA transfected lysate (46.2 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (69.74 KDa).