CSF2RA monoclonal antibody (M03), clone 2G5

• Catalog Number: orb2294049
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant CSF2RA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G5
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CSF2RA (AAH02635.1, 1 a.a. ~ 400 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
• NCBI: AAH02635.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CSF2RA is 3 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between KIT and CSF2RA. HeLa cells were stained with anti-KIT rabbit purified polyclonal 1:1200 and anti-CSF2RA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CSF2RA expression in transfected 293T cell line by CSF2RA monoclonal antibody (M03), clone 2G5. Lane 1: CSF2RA transfected lysate (46.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (69.74 KDa).