CSF1R monoclonal antibody (M02), clone 3G12

• Catalog Number: orb2294065
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CSF1R.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CSF1R (AAH47521, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
• Tested applications: ELISA, PLA, WB
• Clone Number: 3G12
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH47521

CSF1R monoclonal antibody (M02), clone 3G12 Western Blot analysis of CSF1R expression in Hela S3 NE.

Detection limit for recombinant GST tagged CSF1R is approximately 0.3 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between PIK3R1 and CSF1R. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-CSF1R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.63 KDa).