You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294078 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CSE1L. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F4 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 kappa |
Immunogen | CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL |
NCBI | NP_001307 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CSE1L monoclonal antibody (M04), clone 2F4 Western Blot analysis of CSE1L expression in Hela S3 NE.
Detection limit for recombinant GST tagged CSE1L is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 6 ug/ml].
Western Blot detection against Immunogen (36.74 KDa).