CSE1L monoclonal antibody (M04), clone 2F4

• Catalog Number: orb2294078
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CSE1L.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F4
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
• NCBI: NP_001307
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CSE1L monoclonal antibody (M04), clone 2F4 Western Blot analysis of CSE1L expression in Hela S3 NE.

Detection limit for recombinant GST tagged CSE1L is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 6 ug/ml].

Western Blot detection against Immunogen (36.74 KDa).