CSE1L monoclonal antibody (M02), clone 1E4

• Catalog Number: orb2294082
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CSE1L.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E4
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
• NCBI: NP_001307
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CSE1L monoclonal antibody (M02), clone 1E4 Western Blot analysis of CSE1L expression in K-562.

Detection limit for recombinant GST tagged CSE1L is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (36.74 KDa).