Cryptochrome I/CRY1 Antibody

• Catalog Number: orb308835
• Category: Antibodies
• Description: Cryptochrome I/CRY1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino aci
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, RatImmunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 66395 MW
• UniProt ID: Q16526
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Cryptochrome-1;CRY1;PHLL1;
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Cryptochrome I using anti-Cryptochrome I antibody.Lane 1:Rat Brain tissue;2:Rat Testis tissue;3:HELA Cell.

IHC analysis of CRY1 using anti-CRY1 antibody.CRY1 was detected in paraffin-embedded section of mouse intestine tissues.

IHC analysis of CRY1 using anti-CRY1 antibody.CRY1 was detected in paraffin-embedded section of rat intestine tissues.

IHC analysis of CRY1 using anti-CRY1 antibody.CRY1 was detected in paraffin-embedded section of rat intestine tissues.