You have no items in your shopping cart.
Cart summary
CRYGB Protein, Rat, Recombinant (His)
Catalog Number: orb1976620
| Catalog Number | orb1976620 |
|---|---|
| Category | Proteins |
| Description | Crystallins are the dominant structural components of the vertebrate eye lens. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 23.0 kDa (predicted) |
| UniProt ID | P10066 |
| Protein Sequence | GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Rat |
| Biological Activity | Crystallins are the dominant structural components of the vertebrate eye lens. |
| Expression Region | 2-175 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
