CRHBP purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2294149
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CRHBP protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: CRHBP (NP_001873.2, 1 a.a. ~ 322 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
• NCBI: NP_001873.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CRHBP MaxPab rabbit polyclonal antibody. Western Blot analysis of CRHBP expression in human colon.

Western Blot analysis of CRHBP expression in transfected 293T cell line by CRHBP MaxPab polyclonal antibody. Lane 1: CRHBP transfected lysate(36.10 KDa). Lane 2: Non-transfected lysate.