You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
CRHBP monoclonal antibody (M01), clone 3D9
Catalog Number: orb2294148
| Catalog Number | orb2294148 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a full-length recombinant CRHBP. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 3D9 |
| Tested applications | ELISA, IP |
| Reactivity | Human |
| Isotype | IgG2b Kappa |
| Immunogen | CRHBP (AAH18038, 1 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL |
| NCBI | AAH18038 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged CRHBP is 3 ng/ml as a capture antibody.
Immunoprecipitation of CRHBP transfected lysate using anti-CRHBP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRHBP MaxPab rabbit polyclonal antibody.
