CRHBP MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2294150
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CRHBP protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: CRHBP (NP_001873.2, 1 a.a. ~ 322 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
• NCBI: NP_001873.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CRHBP MaxPab rabbit polyclonal antibody. Western Blot analysis of CRHBP expression in human colon.

Immunoprecipitation of CRHBP transfected lysate using anti-CRHBP MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRHBP purified MaxPab mouse polyclonal antibody (B01P) (orb2294151).

Western Blot analysis of CRHBP expression in transfected 293T cell line by CRHBP MaxPab polyclonal antibody. Lane 1: CRHBP transfected lysate(36.10 KDa). Lane 2: Non-transfected lysate.