CREB3 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2291555
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CREB3 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: PLA, WB
• Reactivity: Human
• Immunogen: CREB3 (AAH09402.1, 1 a.a. ~ 371 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
• NCBI: AAH09402.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Proximity Ligation Analysis of protein-protein interactions between CREB3 and CREB3L4. HeLa cells were stained with anti-CREB3 rabbit purified polyclonal 1:1200 and anti-CREB3L4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CREB3 expression in transfected 293T cell line by CREB3 MaxPab polyclonal antibody. Lane 1: CREB3 transfected lysate (41.40 KDa). Lane 2: Non-transfected lysate.

Western Blot analysis of CREB3 recombinant protein (orb2285810) by CREB3 purified MaxPab rabbit polyclonal antibody.