You have no items in your shopping cart.
Cart summary
Item 1 of 7
Item 1 of 7
CPSF6 monoclonal antibody (M10), clone 3F11
Catalog Number: orb2291455
| Catalog Number | orb2291455 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant CPSF6. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 3F11 |
| Tested applications | ELISA, IF, WB |
| Reactivity | Human, Mouse |
| Isotype | IgG2a Kappa |
| Immunogen | CPSF6 (NP_008938, 37 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEAS |
| NCBI | NP_008938 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (36.74 KDa).
CPSF6 monoclonal antibody (M10), clone 3F11 Western Blot analysis of CPSF6 expression in HeLa.
CPSF6 monoclonal antibody (M10), clone 3F11. Western Blot analysis of CPSF6 expression in HL-60.
CPSF6 monoclonal antibody (M10), clone 3F11. Western Blot analysis of CPSF6 expression in Raw 264.7.
Detection limit for recombinant GST tagged CPSF6 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of CPSF6 expression in transfected 293T cell line by CPSF6 monoclonal antibody (M10), clone 3F11. Lane 1: CPSF6 transfected lysate(59.21 KDa). Lane 2: Non-transfected lysate.
