You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294192 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CPS1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CPS1 (NP_001866, 1400 a.a. ~ 1500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 8H8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001866 |
CPS1 monoclonal antibody (M01), clone 8H8 Western Blot analysis of CPS1 expression in HeLa.
Detection limit for recombinant GST tagged CPS1 is approximately 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to CPS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml].
Western Blot detection against Immunogen (36.85 KDa).