CPS1 monoclonal antibody (M01), clone 8H8

• Catalog Number: orb2294192
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CPS1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CPS1 (NP_001866, 1400 a.a. ~ 1500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 8H8
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001866

CPS1 monoclonal antibody (M01), clone 8H8 Western Blot analysis of CPS1 expression in HeLa.

Detection limit for recombinant GST tagged CPS1 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CPS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml].

Western Blot detection against Immunogen (36.85 KDa).