You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2051815 |
---|---|
Category | Proteins |
Description | CPLX2 Recombinant Protein (Human) |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 42.4 kDa |
UniProt ID | Q6PUV4 |
Protein Sequence | MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK |
Source | E.coli |
NCBI | NP_001008221 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | 921-L;complexin II;complexin-2;CPX II;CPX2;CPX-2;H Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
42.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
42.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
42.4 kDa | |
E.coli |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
36.0 kDa | |
E.Coli |
Filter by Rating