CPA2 monoclonal antibody (M02), clone 2E11

• Catalog Number: orb2294211
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CPA2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CPA2 (NP_001860, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: NFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSIT*
• Tested applications: ELISA, IP, WB
• Clone Number: 2E11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001860

Detection limit for recombinant GST tagged CPA2 is 0.3 ng/ml as a capture antibody.

Immunoprecipitation of CPA2 transfected lysate using anti-CPA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CPA2 MaxPab rabbit polyclonal antibody.

Western Blot analysis of CPA2 expression in transfected 293T cell line by CPA2 monoclonal antibody (M02), clone 2E11. Lane 1: CPA2 transfected lysate(46.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.9 KDa).