You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294211 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CPA2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CPA2 (NP_001860, 117 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | NFGAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSIT* |
Tested applications | ELISA, IP, WB |
Clone Number | 2E11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001860 |
Detection limit for recombinant GST tagged CPA2 is 0.3 ng/ml as a capture antibody.
Immunoprecipitation of CPA2 transfected lysate using anti-CPA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CPA2 MaxPab rabbit polyclonal antibody.
Western Blot analysis of CPA2 expression in transfected 293T cell line by CPA2 monoclonal antibody (M02), clone 2E11. Lane 1: CPA2 transfected lysate(46.8 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.9 KDa).