CP11A antibody

• Catalog Number: orb325703
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CP11A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human, Porcine, Rabbit
• Reactivity: Human, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CP11A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: CYP11A1
• UniProt ID: P05108
• Protein Sequence: Synthetic peptide located within the following region: AWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKA
• NCBI: NP_001093243
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CYP11A1 antibody, anti CYP11A antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Ovary Tumor tissue using CP11A antibody