You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
COX6B1 purified MaxPab mouse polyclonal antibody (B01P)
Catalog Number: orb2294233
| Catalog Number | orb2294233 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a full-length human COX6B1 protein. |
| Species/Host | Mouse |
| Clonality | Polyclonal |
| Tested applications | IF, WB |
| Reactivity | Human |
| Immunogen | COX6B1 (NP_001854.1, 1 a.a. ~ 86 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI |
| NCBI | NP_001854.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
COX6B1 MaxPab polyclonal antibody. Western Blot analysis of COX6B1 expression in HepG2.
Immunofluorescence of purified MaxPab antibody to COX6B1 on HepG2 cell. [antibody concentration 10 ug/ml].
Western Blot analysis of COX6B1 expression in transfected 293T cell line by COX6B1 MaxPab polyclonal antibody. Lane 1: COX6B1 transfected lysate(9.46 KDa). Lane 2: Non-transfected lysate.
