Cart summary

You have no items in your shopping cart.

COX5B Peptide - middle region

COX5B Peptide - middle region

Catalog Number: orb1999310

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999310
CategoryProteins
DescriptionCOX5B Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: TGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICE
UniProt IDP10606
MW14 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesCOXVB
NoteFor research use only
NCBINP_001853.2