COX15 monoclonal antibody (M01), clone 2D2

• Catalog Number: orb2294220
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant COX15.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: COX15 (NP_510870, 92 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH
• Tested applications: ELISA, WB
• Clone Number: 2D2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_510870

Detection limit for recombinant GST tagged COX15 is 1 ng/ml as a capture antibody.

Western Blot analysis of COX15 expression in transfected 293T cell line by COX15 monoclonal antibody (M01), clone 2D2. Lane 1: COX15 transfected lysate (Predicted MW: 46 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (32.45 KDa).