You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291310 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CORO1C. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1F7 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | CORO1C (NP_055140, 375 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA |
NCBI | NP_055140 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CORO1C monoclonal antibody (M02), clone 1F7. Western Blot analysis of CORO1C expression in Hela S3 NE.
Detection limit for recombinant GST tagged CORO1C is 0.1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to CORO1C on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (36.63 KDa).