You have no items in your shopping cart.
Cart summary
COPS2 Protein, Human, Recombinant (His)
Catalog Number: orb1978777
| Catalog Number | orb1978777 |
|---|---|
| Category | Proteins |
| Description | COPS2 Protein, Human, Recombinant (His) is expressed in Yeast. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 53.6 kDa (predicted) |
| UniProt ID | P61201 |
| Protein Sequence | MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | COPS2 Protein, Human, Recombinant (His) is expressed in Yeast. |
| Expression Region | 1-443 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
Recombinant Human CSN2/COPS2 Protein, His Tag [orb1552619]
≥90% as determined by SDS-PAGE
This protein contains the human COPS2(Glu26-Val226) was fused with the N-terminal His Tag and expressed in E. coli.
100 μg, 50 μg
