Connexin 45/GJA7/GJC1 Antibody

• Catalog Number: orb18827
• Category: Antibodies
• Description: Connexin 45/GJA7/GJC1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Rat, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 45470 MW
• UniProt ID: P36383
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Gap junction gamma-1 protein;Connexin-45;Cx45;Gap
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody.Lane 1:rat testis tissue.

IHC analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody. Connexin 45/GJA7 was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody. Connexin 45/GJA7 was detected in paraffin-embedded section of rat skeletal muscle tissues.

IHC analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody. Connexin 45/GJA7 was detected in paraffin-embedded section of mouse cardiac muscle tissues.

IHC analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody. Connexin 45/GJA7 was detected in paraffin-embedded section of human placneta tissues.