You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb18827 |
---|---|
Category | Antibodies |
Description | Connexin 45/GJA7/GJC1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Rat, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 45470 MW |
UniProt ID | P36383 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Gap junction gamma-1 protein;Connexin-45;Cx45;Gap Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody.Lane 1:rat testis tissue.
IHC analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody. Connexin 45/GJA7 was detected in paraffin-embedded section of human intestinal cancer tissues.
IHC analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody. Connexin 45/GJA7 was detected in paraffin-embedded section of rat skeletal muscle tissues.
IHC analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody. Connexin 45/GJA7 was detected in paraffin-embedded section of mouse cardiac muscle tissues.
IHC analysis of Connexin 45/GJA7 using anti-Connexin 45/GJA7 antibody. Connexin 45/GJA7 was detected in paraffin-embedded section of human placneta tissues.
WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating