COMT monoclonal antibody (M01), clone 1G4-1A1

• Catalog Number: orb2294247
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant COMT.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G4-1A1
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b kappa
• Immunogen: COMT (AAH00419.2, 1 a.a. ~ 182 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
• NCBI: AAH00419.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

COMT monoclonal antibody (M01), clone 1G4-1A1 Western Blot analysis of COMT expression in A-431.

Detection limit for recombinant GST tagged COMT is 0.3 ng/ml as a capture antibody.

Western Blot analysis of COMT expression in transfected 293T cell line by COMT monoclonal antibody (M01), clone 1G4-1A1. Lane 1: COMT transfected lysate(24.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (45.76 KDa).