You have no items in your shopping cart.
Cart summary
COLEC11 Peptide - N-terminal region
Catalog Number: orb2005934
| Catalog Number | orb2005934 |
|---|---|
| Category | Proteins |
| Description | COLEC11 Peptide - N-terminal region |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 29kDa |
| UniProt ID | Q9BWP8 |
| Protein Sequence | RETKAPPDGLEESAPREKKQSQPVVTASDISKRKCTSSFVEMGSQGDMGD |
| NCBI | NP_954705 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | 3MC2, CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb, CLK Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with COLEC11 Rabbit Polyclonal Antibody (orb586967). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
