You have no items in your shopping cart.
Cart summary
COL18A1 Protein, Human, Recombinant (His)
Catalog Number: orb1978796
| Catalog Number | orb1978796 |
|---|---|
| Category | Proteins |
| Description | COL18A1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.3 kDa and the accession number is P39060. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 21.3 kDa (predicted) |
| UniProt ID | P39060 |
| Protein Sequence | QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | COL18A1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.3 kDa and the accession number is P39060. |
| Expression Region | 1578-1754 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
Recombinant human COL18A1 Protein,C-His (HEK293) [orb2328604]
> 85% as determined by SDS-PAGE
20 μg, 50 μg, 100 μg
