You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2060802 |
---|---|
Category | Proteins |
Description | COL17A1 Recombinant Protein (Human) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 28.4 kDa |
UniProt ID | Q9UMD9 |
Protein Sequence | YLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP |
Source | E.coli |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | 180 kDa bullous pemphigoid antigen 2;alpha 1 type Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
28.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
28.4 kDa | |
E.coli |
98.00% | |
28.4 kDa (predicted) |
Filter by Rating