You have no items in your shopping cart.
Cart summary
COL11A1 Protein, Human, Recombinant (GST)
Catalog Number: orb2816337
| Catalog Number | orb2816337 |
|---|---|
| Category | Proteins |
| Description | COL11A1 Protein, Human, Recombinant (GST) is expressed in P. pastoris (Yeast) with N-GST. The accession number is P12107. |
| Tag | N-GST |
| Protein Sequence | GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ |
| UniProt ID | P12107 |
| MW | 42.8 kDa (Predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Expression Region | 532-699 aa |
| Storage | -20°C |
| Note | For research use only |
