You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290929 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant COG6. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 5B5 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | COG6 (NP_065802, 558 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | QQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLLS |
NCBI | NP_065802 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
COG6 monoclonal antibody (M01), clone 5B5 Western Blot analysis of COG6 expression in A-431.
Detection limit for recombinant GST tagged COG6 is approximately 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa).