Cofilin 2/CFL2 Antibody

• Catalog Number: orb371643
• Category: Antibodies
• Description: Cofilin 2/CFL2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 18737 MW
• UniProt ID: Q9Y281
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Cofilin-2;Cofilin, muscle isoform;CFL2;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Cofilin 2 was detected in paraffin-embedded sections of human prostatic cancer tissues using rabbit anti-Cofilin 2 Antigen Affinity purified polyclonal antibody.The immunohistochemical section was developed using SABC method.

Cofilin 2 was detected in paraffin-embedded sections of mouse cardiac muscle tissues using rabbit anti-Cofilin 2 Antigen Affinity purified polyclonal antibody.The immunohistochemical section was developed using SABC method.

WB analysis of Cofilin 2 expression in rat liver extract (lane 1); mouse brain extract (lane 2) and HELA cell (lane 3).Cofilin 24 at 19KD was detected using rabbit anti-Cofilin 2 Antigen Affinity purified polyclonal antibody.

Cofilin 2 was detected in paraffin-embedded sections of rat skeletal muscle tissues using rabbit anti-Cofilin 2 Antigen Affinity purified polyclonal antibody.The immunohistochemical section was developed using SABC method.