Cart summary

You have no items in your shopping cart.

CNTROB Peptide - C-terminal region

CNTROB Peptide - C-terminal region

Catalog Number: orb2002709

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2002709
CategoryProteins
DescriptionCNTROB Peptide - C-terminal region
Tested applicationsWB
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW95kDa
UniProt IDQ8N137
Protein SequenceSynthetic peptide located within the following region: EANQLLSTTLPPPNPPAPPAGPSSPGPQEPEKEERRVWTMPPMAVALKPV
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesCNTROB,LIP8,PP1221,
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with CNTROB Rabbit Polyclonal Antibody (orb585283). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.