CNR1 monoclonal antibody (M01), clone 2F9

• Catalog Number: orb2294285
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CNR1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F9
• Tested applications: ELISA, WB
• Reactivity: Human, Rat
• Isotype: IgG2b Kappa
• Immunogen: CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV
• NCBI: NP_057167
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CNR1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of CNR1 expression in rat testis.

Detection limit for recombinant GST tagged CNR1 is approximately 0.1 ng/ml as a capture antibody.

Western Blot detection against Immunogen (37.84 KDa).