CNOT3 monoclonal antibody (M01), clone 4B8

• Catalog Number: orb2292505
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CNOT3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4B8
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CNOT3 (NP_055331, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT
• NCBI: NP_055331
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CNOT3 monoclonal antibody (M01), clone 4B8 Western Blot analysis of CNOT3 expression in Hela S3 NE.

Detection limit for recombinant GST tagged CNOT3 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CNOT3 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of CNOT3 expression in transfected 293T cell line by CNOT3 monoclonal antibody (M01), clone 4B8. Lane 1: CNOT3 transfected lysate (82 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).